SCOPe 2.05: Domain d1buua1: 1buu A:105-221

Lineage for d1buua1 (1buu A:105-221)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1buua1: 1buu A:105-221 [42366]
   Other proteins in same PDB: d1buua2
   complexed with ho

Details for d1buua1

PDB Entry: 1buu, 1.9 Å

PDB Description: one ho3+ form of rat mannose-binding protein a

PDB Compounds: (A:) protein (mannose-binding protein a)

SCOPe Domain Sequences for d1buua1:

Sequence; same for both SEQRES and ATOM records:

>d1buua1 d.169.1.1 (A:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1buua1:

• d1buua1 first appeared (with stable ids) in SCOP 1.55
  
• d1buua1 appears in SCOPe 2.04
  
• d1buua1 appears in SCOPe 2.06
  
• d1buua1 appears in the current release, SCOPe 2.08