Lineage for d1buua1 (1buu A:105-221)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878002Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 878003Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 878004Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 878112Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 878115Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 878118Domain d1buua1: 1buu A:105-221 [42366]
    Other proteins in same PDB: d1buua2
    complexed with ho

Details for d1buua1

PDB Entry: 1buu (more details), 1.9 Å

PDB Description: one ho3+ form of rat mannose-binding protein a
PDB Compounds: (A:) protein (mannose-binding protein a)

SCOP Domain Sequences for d1buua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buua1 d.169.1.1 (A:105-221) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

SCOP Domain Coordinates for d1buua1:

Click to download the PDB-style file with coordinates for d1buua1.
(The format of our PDB-style files is described here.)

Timeline for d1buua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1buua2