![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (8 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (28 proteins) Pfam PF00059 |
![]() | Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
![]() | Domain d1buua1: 1buu A:105-221 [42366] Other proteins in same PDB: d1buua2 complexed with ho |
PDB Entry: 1buu (more details), 1.9 Å
SCOP Domain Sequences for d1buua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buua1 d.169.1.1 (A:105-221) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1buua1: