![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
![]() | Domain d1rtm21: 1rtm 2:105-221 [42364] Other proteins in same PDB: d1rtm12, d1rtm22, d1rtm32 complexed with ca, cl, gol |
PDB Entry: 1rtm (more details), 1.8 Å
SCOPe Domain Sequences for d1rtm21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtm21 d.169.1.1 (2:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
Timeline for d1rtm21:
![]() Domains from other chains: (mouse over for more information) d1rtm11, d1rtm12, d1rtm31, d1rtm32 |