SCOP 1.71: Domain d1yttb_: 1ytt B:

Lineage for d1yttb_ (1ytt B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1yttb_: 1ytt B: [42362]
   complexed with yb

Details for d1yttb_

PDB Entry: 1ytt, 1.8 Å

PDB Description: yb substituted subtilisin fragment of mannose binding protein-a (sub- mbp-a), mad structure at 110k

SCOP Domain Sequences for d1yttb_:

Sequence; same for both SEQRES and ATOM records:

>d1yttb_ d.169.1.1 (B:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus)}
gkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevtegq
fmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcef

Timeline for d1yttb_:

• d1yttb_ first appeared (with stable ids) in SCOP 1.55
  
• d1yttb_ appears in SCOP 1.69
  
• d1yttb_ appears in SCOP 1.73
  
• d1yttb_ appears in the current release, SCOPe 2.08