Lineage for d1rdl2_ (1rdl 2:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614429Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 614432Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 614436Domain d1rdl2_: 1rdl 2: [42360]
    complexed with ca, cl, mma

Details for d1rdl2_

PDB Entry: 1rdl (more details), 1.7 Å

PDB Description: mannose-binding protein, subtilisin digest fragment complex with alpha-methyl-d-mannopyranoside (0.2 m)

SCOP Domain Sequences for d1rdl2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdl2_ d.169.1.1 (2:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus)}
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1rdl2_:

Click to download the PDB-style file with coordinates for d1rdl2_.
(The format of our PDB-style files is described here.)

Timeline for d1rdl2_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rdl1_