Lineage for d1hupa1 (1hup A:112-228)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226429Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1226430Species Human (Homo sapiens) [TaxId:9606] [56459] (1 PDB entry)
  8. 1226431Domain d1hupa1: 1hup A:112-228 [42354]
    Other proteins in same PDB: d1hupa2
    complexed with ca, so4

Details for d1hupa1

PDB Entry: 1hup (more details), 2.5 Å

PDB Description: human mannose binding protein carbohydrate recognition domain trimerizes through a triple alpha-helical coiled-coil
PDB Compounds: (A:) mannose-binding protein

SCOPe Domain Sequences for d1hupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
kqvgnkffltngeimtfekvkalcvkfqasvatprnaaengaiqnlikeeaflgitdekt
egqfvdltgnrltytnwnegepnnagsdedcvlllkngqwndvpcstshlavcefpi

SCOPe Domain Coordinates for d1hupa1:

Click to download the PDB-style file with coordinates for d1hupa1.
(The format of our PDB-style files is described here.)

Timeline for d1hupa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hupa2