SCOPe 2.08: Domain d7t2ca2: 7t2c A:84-180

Lineage for d7t2ca2 (7t2c A:84-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7t2ca2: 7t2c A:84-180 [423531]
   Other proteins in same PDB: d7t2ca1, d7t2cb1
   automated match to d4p57c2
   complexed with edo, nag

Details for d7t2ca2

PDB Entry: 7t2c, 3.1 Å

PDB Description: crystal structure of the b5 tcr in complex with hla-dp4-ply

PDB Compounds: (A:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d7t2ca2:

Sequence; same for both SEQRES and ATOM records:

>d7t2ca2 b.1.1.0 (A:84-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndppevtvfpkepvelgqpntlichidkffppvlnvtwlcngelvtegvaeslflprtdy
sfhkfhyltfvpsaedfydcrvehwgldqpllkhwea

Timeline for d7t2ca2:

• d7t2ca2 is new in SCOPe 2.08-stable