Lineage for d1fvud_ (1fvu D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682418Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1682431Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (4 PDB entries)
  8. 1682433Domain d1fvud_: 1fvu D: [42348]
    Other proteins in same PDB: d1fvua_, d1fvuc_
    complexed with mg

Details for d1fvud_

PDB Entry: 1fvu (more details), 1.8 Å

PDB Description: crystal structure of botrocetin
PDB Compounds: (D:) botrocetin beta chain

SCOPe Domain Sequences for d1fvud_:

Sequence, based on SEQRES records: (download)

>d1fvud_ d.169.1.1 (D:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

Sequence, based on observed residues (ATOM records): (download)

>d1fvud_ d.169.1.1 (D:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyliaeyecvaskptnnkwwiipctrfknfvcefq
a

SCOPe Domain Coordinates for d1fvud_:

Click to download the PDB-style file with coordinates for d1fvud_.
(The format of our PDB-style files is described here.)

Timeline for d1fvud_: