SCOPe 2.08: Domain d8f0ac2: 8f0a C:260-359

Lineage for d8f0ac2 (8f0a C:260-359)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
   duplication: tandem repeat of two PDZ domains

7. Species Escherichia coli [TaxId:562] [74935] (5 PDB entries)

8. Domain d8f0ac2: 8f0a C:260-359 [423419]
   Other proteins in same PDB: d8f0aa1, d8f0ab1, d8f0ac1
   automated match to d1ky9a1

Details for d8f0ac2

PDB Entry: 8f0a, 2.6 Å

PDB Description: client-bound structure of a degp trimer within a 12mer cage

PDB Compounds: (C:) periplasmic serine endoprotease degp

SCOPe Domain Sequences for d8f0ac2:

Sequence; same for both SEQRES and ATOM records:

>d8f0ac2 b.36.1.4 (C:260-359) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqssq

Timeline for d8f0ac2:

• d8f0ac2 is new in SCOPe 2.08-stable