| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Snake coagglutinin beta chain [88867] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
| Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries) |
| Domain d1ixxd_: 1ixx D: [42338] Other proteins in same PDB: d1ixxa_, d1ixxc_, d1ixxe_ complexed with ca |
PDB Entry: 1ixx (more details), 2.5 Å
SCOPe Domain Sequences for d1ixxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixxd_ d.169.1.1 (D:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa
Timeline for d1ixxd_: