Lineage for d1ixxc_ (1ixx C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442853Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1442854Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)
  8. 1442860Domain d1ixxc_: 1ixx C: [42337]
    Other proteins in same PDB: d1ixxb_, d1ixxd_, d1ixxf_
    complexed with ca

Details for d1ixxc_

PDB Entry: 1ixx (more details), 2.5 Å

PDB Description: crystal structure of coagulation factors ix/x-binding protein (ix/x-bp) from venom of habu snake with a heterodimer of c-type lectin domains
PDB Compounds: (C:) coagulation factors ix/x-binding protein

SCOPe Domain Sequences for d1ixxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixxc_ d.169.1.1 (C:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk
rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg
qqnpfvcea

SCOPe Domain Coordinates for d1ixxc_:

Click to download the PDB-style file with coordinates for d1ixxc_.
(The format of our PDB-style files is described here.)

Timeline for d1ixxc_: