![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (5 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (13 proteins) |
![]() | Protein Snake coagglutinin [56446] (3 species) |
![]() | Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [56447] (2 PDB entries) |
![]() | Domain d1ixxc_: 1ixx C: [42337] |
PDB Entry: 1ixx (more details), 2.5 Å
SCOP Domain Sequences for d1ixxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixxc_ d.169.1.1 (C:) Snake coagglutinin {Habu snake (Trimeresurus flavoviridis)} dclsgwssyeghcykafekyktwedaervcteqakgahlvsiessgeadfvaqlvtqnmk rldfyiwiglrvqgkvkqcnsewsdgssvsyenwieaesktclgleketdfrkwvniycg qqnpfvcea
Timeline for d1ixxc_: