Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Macrophage mannose receptor, CRD4 [56444] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56445] (2 PDB entries) |
Domain d1eggb_: 1egg B: [42334] complexed with ca |
PDB Entry: 1egg (more details), 2.3 Å
SCOPe Domain Sequences for d1eggb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eggb_ d.169.1.1 (B:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} ipkcpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrl itasgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptm swndincehlnnwicqiqkgqtpk
Timeline for d1eggb_: