Lineage for d7us7a_ (7us7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3004094Protein automated matches [190421] (6 species)
    not a true protein
  7. 3004267Species Human (Homo sapiens) [TaxId:9606] [187302] (89 PDB entries)
  8. 3087004Domain d7us7a_: 7us7 A: [423321]
    Other proteins in same PDB: d7us7b2, d7us7c2
    automated match to d4ucha_
    complexed with gol, h4b, hem, o5x, zn; mutant

Details for d7us7a_

PDB Entry: 7us7 (more details), 1.93 Å

PDB Description: structure of human neuronal nitric oxide synthase r354a/g357d mutant heme domain in complex with 6-(4-(dimethylamino)but-1-yn-1-yl)-4- methylpyridin-2-amine
PDB Compounds: (A:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d7us7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7us7a_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfplak
efidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgri
qwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsql
iryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippe
lvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdyc
dnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfi
khmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk

SCOPe Domain Coordinates for d7us7a_:

Click to download the PDB-style file with coordinates for d7us7a_.
(The format of our PDB-style files is described here.)

Timeline for d7us7a_:

  • d7us7a_ is new in SCOPe 2.08-stable