Lineage for d4ucha_ (4uch A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. Protein automated matches [190421] (6 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187302] (87 PDB entries)
  8. Domain d4ucha_: 4uch A: [268945]
    automated match to d3hsob_
    complexed with h4b, hem, olw, zn; mutant

Details for d4ucha_

PDB Entry: 4uch (more details), 2.2 Å

PDB Description: structure of human nnos r354a g357d mutant heme domain in complex with 3-(((2-((2-(1h-imidazol-1-yl)pyrimidin-4-yl) ethyl)amino)methyl)benzonitrile
PDB Compounds: (A:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d4ucha_:

Sequence, based on SEQRES records: (download)

>d4ucha_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
kg

Sequence, based on observed residues (ATOM records): (download)

>d4ucha_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpdvatkdqlfplakefidq
yyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwskl
qvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryag
ykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlev
pirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsry
nileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmen
eyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg

SCOPe Domain Coordinates for d4ucha_ are not available.

Timeline for d4ucha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4uchb_