Lineage for d7vp9g_ (7vp9 G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852398Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (4 PDB entries)
    Uniprot Q16740 57-249
  8. 3086988Domain d7vp9g_: 7vp9 G: [423305]
    automated match to d1tg6e_
    complexed with 7sr, mg

Details for d7vp9g_

PDB Entry: 7vp9 (more details), 2.55 Å

PDB Description: crystal structure of human clpp in complex with zg111
PDB Compounds: (G:) ATP-dependent Clp protease proteolytic subunit, mitochondrial

SCOPe Domain Sequences for d7vp9g_:

Sequence, based on SEQRES records: (download)

>d7vp9g_ c.14.1.1 (G:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
lipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihm
yinspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimi
hqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqe
fgildkvlvhpp

Sequence, based on observed residues (ATOM records): (download)

>d7vp9g_ c.14.1.1 (G:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
lipivydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggvvt
aglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiqaeeim
klkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhpp

SCOPe Domain Coordinates for d7vp9g_:

Click to download the PDB-style file with coordinates for d7vp9g_.
(The format of our PDB-style files is described here.)

Timeline for d7vp9g_:

  • d7vp9g_ is new in SCOPe 2.08-stable