Lineage for d1e87a_ (1e87 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85600Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 85601Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 85602Family d.169.1.1: C-type lectin domain [56437] (15 proteins)
  6. 85603Protein CD69 [56442] (1 species)
  7. 85604Species Human (Homo sapiens) [TaxId:9606] [56443] (3 PDB entries)
  8. 85605Domain d1e87a_: 1e87 A: [42327]

Details for d1e87a_

PDB Entry: 1e87 (more details), 1.5 Å

PDB Description: human cd69 - trigonal form

SCOP Domain Sequences for d1e87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens)}
sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

SCOP Domain Coordinates for d1e87a_:

Click to download the PDB-style file with coordinates for d1e87a_.
(The format of our PDB-style files is described here.)

Timeline for d1e87a_: