Lineage for d1e87a_ (1e87 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001359Protein CD69 [56442] (1 species)
  7. 3001360Species Human (Homo sapiens) [TaxId:9606] [56443] (3 PDB entries)
  8. 3001361Domain d1e87a_: 1e87 A: [42327]
    complexed with gol, zn

Details for d1e87a_

PDB Entry: 1e87 (more details), 1.5 Å

PDB Description: human cd69 - trigonal form
PDB Compounds: (A:) early activation antigen cd69

SCOPe Domain Sequences for d1e87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]}
sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

SCOPe Domain Coordinates for d1e87a_:

Click to download the PDB-style file with coordinates for d1e87a_.
(The format of our PDB-style files is described here.)

Timeline for d1e87a_: