Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein CD69 [56442] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56443] (3 PDB entries) |
Domain d1e87a_: 1e87 A: [42327] complexed with gol, zn |
PDB Entry: 1e87 (more details), 1.5 Å
SCOPe Domain Sequences for d1e87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
Timeline for d1e87a_: