PDB entry 1e87

View 1e87 on RCSB PDB site
Description: human cd69 - trigonal form
Class: sugar binding protein
Keywords: hematopoietic cell receptor, leucocyte, nkd, klr, sugar binding protein
Deposited on 2000-09-18, released 2000-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.229
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: early activation antigen cd69
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e87a_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1e87A (A:)
vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

    Sequence, based on observed residues (ATOM records): (download) 
    >1e87A (A:)
sscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreehw
vglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk