SCOP 1.59: Domain d1lit__: 1lit -

Lineage for d1lit__ (1lit -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (17 proteins)

6. Protein Lithostathine, inhibitor of stone formation [56438] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56439] (2 PDB entries)

8. Domain d1lit__: 1lit - [42325]

Details for d1lit__

PDB Entry: 1lit, 1.55 Å

PDB Description: human lithostathine

SCOP Domain Sequences for d1lit__:

Sequence; same for both SEQRES and ATOM records:

>d1lit__ d.169.1.1 (-) Lithostathine, inhibitor of stone formation {Human (Homo sapiens)}
cpegtnayrsycyyfnedretwvdadlycqnmnsgnlvsvltqaegafvaslikesgtdd
fnvwiglhdpkknrrwhwssgslvsykswgigapssvnpgycvsltsstgfqkwkdvpce
dkfsfvckfkn

Timeline for d1lit__:

• d1lit__ first appeared (with stable ids) in SCOP 1.55
  
• d1lit__ appears in SCOP 1.57
  
• d1lit__ appears in SCOP 1.61
  
• d1lit__ appears in the current release, SCOPe 2.08, called d1lita_