SCOP 1.73: Domain d1defa_: 1def A:

Lineage for d1defa_ (1def A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (9 species)

7. Species Escherichia coli [TaxId:562] [56423] (19 PDB entries)

8. Domain d1defa_: 1def A: [42306]
   incorrect model(?)
   complexed with zn

Details for d1defa_

PDB Entry: 1def

PDB Description: peptide deformylase catalytic core (residues 1-147), nmr, 9 structures

PDB Compounds: (A:) Peptide deformylase

SCOP Domain Sequences for d1defa_:

Sequence; same for both SEQRES and ATOM records:

>d1defa_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdyls

Timeline for d1defa_:

• d1defa_ first appeared (with stable ids) in SCOP 1.55, called d1def__
  
• d1defa_ was called d1def__ in SCOP 1.71
  
• d1defa_ appears in SCOP 1.75
  
• d1defa_ appears in the current release, SCOPe 2.08