|  | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) | 
|  | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold | 
|  | Superfamily d.166.1: ADP-ribosylation [56399] (8 families)  | 
|  | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) | 
|  | Protein Vegetative insecticidal protein 2 (VIP2) [56412] (1 species) duplication: consists of two domains of this fold, the second of which is catalytic | 
|  | Species Bacillus cereus [TaxId:1396] [56413] (2 PDB entries) | 
|  | Domain d1qs1b2: 1qs1 B:1265-1461 [42263] | 
PDB Entry: 1qs1 (more details), 1.5 Å
SCOPe Domain Sequences for d1qs1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs1b2 d.166.1.1 (B:1265-1461) Vegetative insecticidal protein 2 (VIP2) {Bacillus cereus [TaxId: 1396]}
sldfkndinaeahswgmknyeewakdltdsqrealdgyarqdykeinnylrnqggsgnek
ldaqiknisdalgkkpipenitvyrwcgmpefgyqisdplpslkdfeeqflntikedkgy
mstslsserlaafgsrkiilrlqvpkgstgaylsaiggfasekeilldkdskyhidkvte
viikgvkryvvdatllt
Timeline for d1qs1b2: