Lineage for d1ptog_ (1pto G:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614029Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 614030Superfamily d.166.1: ADP-ribosylation [56399] (5 families) (S)
  5. 614031Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)
  6. 614123Protein Pertussis toxin, S1 subunit [56408] (1 species)
  7. 614124Species Bordetella pertussis [TaxId:520] [56409] (3 PDB entries)
  8. 614130Domain d1ptog_: 1pto G: [42258]
    Other proteins in same PDB: d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_
    complexed with gal, sia

Details for d1ptog_

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptog_:

Sequence, based on SEQRES records: (download)

>d1ptog_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf

Sequence, based on observed residues (ATOM records): (download)

>d1ptog_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf

SCOP Domain Coordinates for d1ptog_:

Click to download the PDB-style file with coordinates for d1ptog_.
(The format of our PDB-style files is described here.)

Timeline for d1ptog_: