Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (5 families) |
Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins) |
Protein Pertussis toxin, S1 subunit [56408] (1 species) |
Species Bordetella pertussis [TaxId:520] [56409] (3 PDB entries) |
Domain d1ptog_: 1pto G: [42258] Other proteins in same PDB: d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_ complexed with gal, sia |
PDB Entry: 1pto (more details), 3.5 Å
SCOP Domain Sequences for d1ptog_:
Sequence, based on SEQRES records: (download)
>d1ptog_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis} dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf
>d1ptog_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis} dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
Timeline for d1ptog_: