Class b: All beta proteins [48724] (149 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species) N-terminal domain in S2/S3 has C-lectin-like fold |
Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries) |
Domain d1ptoi1: 1pto I:90-199 [25127] Other proteins in same PDB: d1ptoa_, d1ptob2, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptog_, d1ptoh2, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_ complexed with gal, sia |
PDB Entry: 1pto (more details), 3.5 Å
SCOP Domain Sequences for d1ptoi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptoi1 b.40.2.1 (I:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis} tiyktgqpaadhyyskvtatrllastnsrlcavfvrdgqsvigacaspyegryrdmydal rrllymiymsglavrvhvskeeqyydyedatfqtyaltgislcnpaasic
Timeline for d1ptoi1: