Lineage for d7luia_ (7lui A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878773Protein automated matches [190208] (8 species)
    not a true protein
  7. 2878811Species Vibrio cholerae [TaxId:243277] [194420] (2 PDB entries)
  8. 3086053Domain d7luia_: 7lui A: [422370]
    automated match to d2ijya_
    complexed with gol, tch

Details for d7luia_

PDB Entry: 7lui (more details), 1.74 Å

PDB Description: crystal structure of vibrio cholerae dsba in complex with bile salt taurocholate
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d7luia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7luia_ c.47.1.13 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
qfkegehyqvlktpassspvvseffsfycphcntfepiiaqlkqqlpegakfqknhvsfm
ggnmgqamskayatmialevedkmvpvmfnrihtlrkppkdeqelrqifldegidaakfd
aayngfavdsmvrrfdkqfqdsgltgvpavvvnnrylvqgqsaksldeyfdlvnylltlk

SCOPe Domain Coordinates for d7luia_:

Click to download the PDB-style file with coordinates for d7luia_.
(The format of our PDB-style files is described here.)

Timeline for d7luia_:

  • d7luia_ is new in SCOPe 2.08-stable