Lineage for d1ltb.1 (1ltb A:,C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681419Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1681420Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1681421Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1681530Protein Heat-labile toxin, A-chain [56401] (2 species)
  7. 1681531Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)
  8. 1681539Domain d1ltb.1: 1ltb A:,C: [42236]
    Other proteins in same PDB: d1ltbd_, d1ltbe_, d1ltbf_, d1ltbg_, d1ltbh_

Details for d1ltb.1

PDB Entry: 1ltb (more details), 2.6 Å

PDB Description: 2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)
PDB Compounds: (A:) heat-labile enterotoxin, subunit a, (C:) heat-labile enterotoxin, subunit a

SCOPe Domain Sequences for d1ltb.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ltb.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB [TaxId: 562]}
rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

SCOPe Domain Coordinates for d1ltb.1:

Click to download the PDB-style file with coordinates for d1ltb.1.
(The format of our PDB-style files is described here.)

Timeline for d1ltb.1: