SCOPe 2.08: Domain d7n3ka1: 7n3k A:1-113

Lineage for d7n3ka1 (7n3k A:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (2 families)

5. Family b.140.1.1: Replicase NSP9 [101817] (2 proteins)
   automatically mapped to Pfam PF08710

6. Protein automated matches [191025] (2 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382506] (7 PDB entries)

8. Domain d7n3ka1: 7n3k A:1-113 [422104]
   Other proteins in same PDB: d7n3ka2, d7n3kb2, d7n3kc2, d7n3kd2, d7n3ke2, d7n3kf2, d7n3kh2
   automated match to d6wxda_
   protein/RNA complex; complexed with odn, so4

Details for d7n3ka1

PDB Entry: 7n3k, 3 Å

PDB Description: oridonin-bound sars-cov-2 nsp9

PDB Compounds: (A:) Non-structural protein 9

SCOPe Domain Sequences for d7n3ka1:

Sequence; same for both SEQRES and ATOM records:

>d7n3ka1 b.140.1.1 (A:1-113) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
nnelspvalrqmscaagttqtactddnalayynttkggrfvlallsdlqdlkwarfpksd
gtgtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvrlq

Timeline for d7n3ka1:

• d7n3ka1 is new in SCOPe 2.08-stable