Lineage for d1pagb_ (1pag B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606001Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 2606002Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 2606014Domain d1pagb_: 1pag B: [42209]
    complexed with fmp

Details for d1pagb_

PDB Entry: 1pag (more details), 2.8 Å

PDB Description: the 2.5 angstroms structure of pokeweed antiviral protein
PDB Compounds: (B:) pokeweed antiviral protein

SCOPe Domain Sequences for d1pagb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pagb_ d.165.1.1 (B:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOPe Domain Coordinates for d1pagb_:

Click to download the PDB-style file with coordinates for d1pagb_.
(The format of our PDB-style files is described here.)

Timeline for d1pagb_: