Lineage for d7m2kg_ (7m2k G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939466Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2939467Protein automated matches [190120] (9 species)
    not a true protein
  7. 2939474Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)
  8. 3085759Domain d7m2kg_: 7m2k G: [422076]
    Other proteins in same PDB: d7m2kb1, d7m2kb2, d7m2kd1, d7m2kd2, d7m2kf_, d7m2kh_
    automated match to d4mdka_
    complexed with gzm

Details for d7m2kg_

PDB Entry: 7m2k (more details), 2.47 Å

PDB Description: cdc34a-ubiquitin-2ab inhibitor complex
PDB Compounds: (G:) Ubiquitin-conjugating enzyme E2 R1

SCOPe Domain Sequences for d7m2kg_:

Sequence, based on SEQRES records: (download)

>d7m2kg_ d.20.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi
dypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtills
visllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp

Sequence, based on observed residues (ATOM records): (download)

>d7m2kg_ d.20.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi
dypysppafrfltkmwhpniyetgdvcinptqnvrtillsvisllnepntfspanvdasv
myrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp

SCOPe Domain Coordinates for d7m2kg_:

Click to download the PDB-style file with coordinates for d7m2kg_.
(The format of our PDB-style files is described here.)

Timeline for d7m2kg_:

  • d7m2kg_ is new in SCOPe 2.08-stable