Lineage for d1apaa_ (1apa A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. Domain d1apaa_: 1apa A: [42205]

Details for d1apaa_

PDB Entry: 1apa (more details), 2.3 Å

PDB Description: x-ray structure of a pokeweed antiviral protein, coded by a new genomic clone, at 0.23 nm resolution. a model structure provides a suitable electrostatic field for substrate binding.
PDB Compounds: (A:) pokeweed antiviral protein

SCOPe Domain Sequences for d1apaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apaa_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
intitfdvgnatinkyatfmksihnqakdptlkcygipmlpntnltpkyllvtlqdsslk
titlmlkrnnlyvmgyadtyngkcryhifkdisntterndvmttlcpnpssrvgkninyd
ssypalekkvgrprsqvqlgiqilnsgigkiygvdsftekteaefllvaiqmvseaarfk
yienqvktnfnrafypnakvlnleeswgkistaihnakngaltsplelknangskwivlr
vddiepdvgllkyvngtcqat

SCOPe Domain Coordinates for d1apaa_ are not available.

Timeline for d1apaa_: