Lineage for d1apa__ (1apa -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37111Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 37112Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 37113Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 37155Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 37156Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 37165Domain d1apa__: 1apa - [42205]

Details for d1apa__

PDB Entry: 1apa (more details), 2.3 Å

PDB Description: x-ray structure of a pokeweed antiviral protein, coded by a new genomic clone, at 0.23 nm resolution. a model structure provides a suitable electrostatic field for substrate binding.

SCOP Domain Sequences for d1apa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apa__ d.165.1.1 (-) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana)}
intitfdvgnatinkyatfmksihnqakdptlkcygipmlpntnltpkyllvtlqdsslk
titlmlkrnnlyvmgyadtyngkcryhifkdisntterndvmttlcpnpssrvgkninyd
ssypalekkvgrprsqvqlgiqilnsgigkiygvdsftekteaefllvaiqmvseaarfk
yienqvktnfnrafypnakvlnleeswgkistaihnakngaltsplelknangskwivlr
vddiepdvgllkyvngtcqat

SCOP Domain Coordinates for d1apa__:

Click to download the PDB-style file with coordinates for d1apa__.
(The format of our PDB-style files is described here.)

Timeline for d1apa__: