Lineage for d1d6aa_ (1d6a A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606001Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 2606002Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 2606011Domain d1d6aa_: 1d6a A: [42197]
    complexed with gun

Details for d1d6aa_

PDB Entry: 1d6a (more details), 2.1 Å

PDB Description: structure of pokeweed antiviral protein complexed with guanine
PDB Compounds: (A:) pokeweed antiviral protein

SCOPe Domain Sequences for d1d6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6aa_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOPe Domain Coordinates for d1d6aa_:

Click to download the PDB-style file with coordinates for d1d6aa_.
(The format of our PDB-style files is described here.)

Timeline for d1d6aa_: