Lineage for d1aha__ (1aha -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420925Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 420926Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 420927Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)
  6. 420931Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 420932Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)
  8. 420937Domain d1aha__: 1aha - [42187]
    complexed with ade

Details for d1aha__

PDB Entry: 1aha (more details), 2.2 Å

PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin

SCOP Domain Sequences for d1aha__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aha__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOP Domain Coordinates for d1aha__:

Click to download the PDB-style file with coordinates for d1aha__.
(The format of our PDB-style files is described here.)

Timeline for d1aha__: