SCOP 1.65: Domain d1aha__: 1aha -

Lineage for d1aha__ (1aha -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (12 proteins)

6. Protein alpha-Momorcharin (momordin) [56377] (1 species)

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)

8. Domain d1aha__: 1aha - [42187]
   complexed with ade

Details for d1aha__

PDB Entry: 1aha, 2.2 Å

PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin

SCOP Domain Sequences for d1aha__:

Sequence; same for both SEQRES and ATOM records:

>d1aha__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

Timeline for d1aha__:

• d1aha__ first appeared (with stable ids) in SCOP 1.55
  
• d1aha__ appears in SCOP 1.63
  
• d1aha__ appears in SCOP 1.67
  
• d1aha__ appears in the current release, SCOPe 2.08, called d1ahaa_