SCOP 1.61: Domain d1tcs__: 1tcs -

Lineage for d1tcs__ (1tcs -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)

6. Protein alpha-Trichosanthin [56373] (1 species)

7. Species Mongolian snake gourd (Trichosanthes kirilowii maxim) [56374] (5 PDB entries)

8. Domain d1tcs__: 1tcs - [42179]

Details for d1tcs__

PDB Entry: 1tcs, 1.7 Å

PDB Description: crystal structure of trichosanthin-nadph complex at 1.7 angstroms resolution reveals active-site architecture

SCOP Domain Sequences for d1tcs__:

Sequence; same for both SEQRES and ATOM records:

>d1tcs__ d.165.1.1 (-) alpha-Trichosanthin {Mongolian snake gourd (Trichosanthes kirilowii maxim)}
dvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadeti
svaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaagk
ireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktfl
pslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsniall
lnrnnma

Timeline for d1tcs__:

• d1tcs__ first appeared (with stable ids) in SCOP 1.55
  
• d1tcs__ appears in SCOP 1.59
  
• d1tcs__ appears in SCOP 1.63
  
• d1tcs__ appears in the current release, SCOPe 2.08, called d1tcsa_