SCOPe 2.08: Domain d7eo7b_: 7eo7 B:

Lineage for d7eo7b_ (7eo7 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (36 species)
   not a true protein

7. Species Human coronavirus nl63 [TaxId:277944] [421509] (5 PDB entries)

8. Domain d7eo7b_: 7eo7 B: [421740]
   automated match to d6w81a_
   complexed with fno

Details for d7eo7b_

PDB Entry: 7eo7, 2.25 Å

PDB Description: crystal structure of hcov-nl63 3c-like protease in complex with an inhibitor shikonin

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d7eo7b_:

Sequence; same for both SEQRES and ATOM records:

>d7eo7b_ b.47.1.0 (B:) automated matches {Human coronavirus nl63 [TaxId: 277944]}
glkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystmr
lhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegia
sgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgsv
ygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyts
vssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv

Timeline for d7eo7b_:

• d7eo7b_ is new in SCOPe 2.08-stable