Lineage for d1crxb2 (1crx B:130-341)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139125Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
  4. 139126Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 139127Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 139128Protein Cre recombinase [56355] (1 species)
  7. 139129Species Bacteriophage P1 [TaxId:10678] [56356] (7 PDB entries)
  8. 139134Domain d1crxb2: 1crx B:130-341 [42158]
    Other proteins in same PDB: d1crxa1, d1crxb1

Details for d1crxb2

PDB Entry: 1crx (more details), 2.4 Å

PDB Description: cre recombinase/dna complex reaction intermediate i

SCOP Domain Sequences for d1crxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crxb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOP Domain Coordinates for d1crxb2:

Click to download the PDB-style file with coordinates for d1crxb2.
(The format of our PDB-style files is described here.)

Timeline for d1crxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1crxb1