Lineage for d1a5z_2 (1a5z 164-333)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613582Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 613583Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 613584Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 613591Protein Lactate dehydrogenase [56339] (15 species)
  7. 613661Species Thermotoga maritima [TaxId:243274] [56347] (1 PDB entry)
  8. 613662Domain d1a5z_2: 1a5z 164-333 [42148]
    Other proteins in same PDB: d1a5z_1
    complexed with cd, fbp, nad, oxm

Details for d1a5z_2

PDB Entry: 1a5z (more details), 2.1 Å

PDB Description: lactate dehydrogenase from thermotoga maritima (tmldh)

SCOP Domain Sequences for d1a5z_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5z_2 d.162.1.1 (164-333) Lactate dehydrogenase {Thermotoga maritima}
gtvldtarlrtliaqhcgfsprsvhvyvigehgdsevpvwsgamiggiplqnmcqvcqkc
dskilenfaektkraayeiierkgathyaialavadivesiffdekrvltlsvyledylg
vkdlcisvpvtlgkhgverilelnlneeeleafrksasilknaineitaeen

SCOP Domain Coordinates for d1a5z_2:

Click to download the PDB-style file with coordinates for d1a5z_2.
(The format of our PDB-style files is described here.)

Timeline for d1a5z_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5z_1