Lineage for d1lthr2 (1lth R:150-319)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938764Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)
  8. 1938767Domain d1lthr2: 1lth R:150-319 [42146]
    Other proteins in same PDB: d1lthr1, d1ltht1
    complexed with fbp, nad, oxm

Details for d1lthr2

PDB Entry: 1lth (more details), 2.5 Å

PDB Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control
PDB Compounds: (R:) l-lactate dehydrogenase (t- and r- state tetramer complex)

SCOPe Domain Sequences for d1lthr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lthr2 d.162.1.1 (R:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

SCOPe Domain Coordinates for d1lthr2:

Click to download the PDB-style file with coordinates for d1lthr2.
(The format of our PDB-style files is described here.)

Timeline for d1lthr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lthr1