Lineage for d1lthr1 (1lth R:7-149)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829434Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries)
  8. 1829437Domain d1lthr1: 1lth R:7-149 [30179]
    Other proteins in same PDB: d1lthr2, d1ltht2
    complexed with fbp, nad, oxm

Details for d1lthr1

PDB Entry: 1lth (more details), 2.5 Å

PDB Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control
PDB Compounds: (R:) l-lactate dehydrogenase (t- and r- state tetramer complex)

SCOPe Domain Sequences for d1lthr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lthr1 c.2.1.5 (R:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg

SCOPe Domain Coordinates for d1lthr1:

Click to download the PDB-style file with coordinates for d1lthr1.
(The format of our PDB-style files is described here.)

Timeline for d1lthr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lthr2