Class g: Small proteins [56992] (100 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species) duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6 |
Species Human (Homo sapiens) [TaxId:9606] [161129] (7 PDB entries) Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108 |
Domain d7e17b1: 7e17 B:1-86 [421421] Other proteins in same PDB: d7e17a4, d7e17b4 automated match to d3bt1u1 complexed with nag |
PDB Entry: 7e17 (more details), 2.96 Å
SCOPe Domain Sequences for d7e17b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e17b1 g.7.1.3 (B:1-86) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]} lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg lkitsltevvcgldlcnqgnsgravt
Timeline for d7e17b1:
View in 3D Domains from other chains: (mouse over for more information) d7e17a1, d7e17a2, d7e17a3, d7e17a4 |