Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) |
Protein Lactate dehydrogenase [56339] (15 species) |
Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) |
Domain d1ldba2: 1ldb A:163-331 [42141] Other proteins in same PDB: d1ldba1, d1ldbb1, d1ldbc1, d1ldbd1 complexed with so4 |
PDB Entry: 1ldb (more details), 2.8 Å
SCOP Domain Sequences for d1ldba2:
Sequence, based on SEQRES records: (download)
>d1ldba2 d.162.1.1 (A:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
>d1ldba2 d.162.1.1 (A:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpidlerifvnvrd aayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyigvpavinr ngirevieielnddeknrfhhsaatlksvlaraftr
Timeline for d1ldba2: