SCOP 1.61: Domain d1ldnh2: 1ldn H:163-330

Lineage for d1ldnh2 (1ldn H:163-330)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family)
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
Protein Lactate dehydrogenase [56339] (11 species)
Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
Domain d1ldnh2: 1ldn H:163-330 [42140]
Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1

Details for d1ldnh2

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

SCOP Domain Sequences for d1ldnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldnh2 d.162.1.1 (H:163-330) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

SCOP Domain Coordinates for d1ldnh2:

Click to download the PDB-style file with coordinates for d1ldnh2.
(The format of our PDB-style files is described here.)

Timeline for d1ldnh2: