Lineage for d1ldne2 (1ldn E:163-330)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139007Protein Lactate dehydrogenase [56339] (11 species)
  7. 139008Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 139013Domain d1ldne2: 1ldn E:163-330 [42137]
    Other proteins in same PDB: d1ldna1, d1ldnb1, d1ldnc1, d1ldnd1, d1ldne1, d1ldnf1, d1ldng1, d1ldnh1

Details for d1ldne2

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

SCOP Domain Sequences for d1ldne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldne2 d.162.1.1 (E:163-330) Lactate dehydrogenase {Bacillus stearothermophilus}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft

SCOP Domain Coordinates for d1ldne2:

Click to download the PDB-style file with coordinates for d1ldne2.
(The format of our PDB-style files is described here.)

Timeline for d1ldne2: