SCOPe 2.08: Domain d7dt9a1: 7dt9 A:1-99

Lineage for d7dt9a1 (7dt9 A:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d7dt9a1: 7dt9 A:1-99 [421342]
   automated match to d4q5ma1
   complexed with roc

Details for d7dt9a1

PDB Entry: 7dt9, 1.89 Å

PDB Description: d30n hiv protease in complex with saquinavir

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d7dt9a1:

Sequence; same for both SEQRES and ATOM records:

>d7dt9a1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf

Timeline for d7dt9a1:

• d7dt9a1 is new in SCOPe 2.08-stable