Lineage for d1bmdb2 (1bmd B:155-332)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139061Protein Malate dehydrogenase [56329] (10 species)
  7. 139115Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)
  8. 139119Domain d1bmdb2: 1bmd B:155-332 [42107]
    Other proteins in same PDB: d1bmda1, d1bmdb1

Details for d1bmdb2

PDB Entry: 1bmd (more details), 1.9 Å

PDB Description: determinants of protein thermostability observed in the 1.9 angstroms crystal structure of malate dehydrogenase from the thermophilic bacterium thermus flavus

SCOP Domain Sequences for d1bmdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmdb2 d.162.1.1 (B:155-332) Malate dehydrogenase {Thermus flavus}
trldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOP Domain Coordinates for d1bmdb2:

Click to download the PDB-style file with coordinates for d1bmdb2.
(The format of our PDB-style files is described here.)

Timeline for d1bmdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bmdb1