Lineage for d1bdmb2 (1bdm B:155-332)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139061Protein Malate dehydrogenase [56329] (10 species)
  7. 139115Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)
  8. 139117Domain d1bdmb2: 1bdm B:155-332 [42105]
    Other proteins in same PDB: d1bdma1, d1bdmb1

Details for d1bdmb2

PDB Entry: 1bdm (more details), 1.8 Å

PDB Description: the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity

SCOP Domain Sequences for d1bdmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdmb2 d.162.1.1 (B:155-332) Malate dehydrogenase {Thermus flavus}
trldhnrakaqlakktgtgvdrirrmtvwgnhssimfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOP Domain Coordinates for d1bdmb2:

Click to download the PDB-style file with coordinates for d1bdmb2.
(The format of our PDB-style files is described here.)

Timeline for d1bdmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bdmb1