Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (6 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [420916] (1 PDB entry) |
Domain d7cxde_: 7cxd E: [420927] automated match to d6fofd_ complexed with br, td2 |
PDB Entry: 7cxd (more details), 1.71 Å
SCOPe Domain Sequences for d7cxde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cxde_ b.29.1.3 (E:) automated matches {Rattus norvegicus [TaxId: 10116]} tvpydmplpggvmprmlitiigtvkpnansitlnfkkgndiafhfnprfnennrrvivcn tkqdnnwgreerqsafpfesgkpfkiqvlveadhfkvavndvhllqynhrmknlreisql giigditltsashami
Timeline for d7cxde_: