Lineage for d7cxde_ (7cxd E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 3084599Species Rattus norvegicus [TaxId:10116] [420916] (1 PDB entry)
  8. 3084610Domain d7cxde_: 7cxd E: [420927]
    automated match to d6fofd_
    complexed with br, td2

Details for d7cxde_

PDB Entry: 7cxd (more details), 1.71 Å

PDB Description: xray structure of rat galectin-3 crd in complex with td-139 belonging to p121 space group
PDB Compounds: (E:) Galectin-3

SCOPe Domain Sequences for d7cxde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cxde_ b.29.1.3 (E:) automated matches {Rattus norvegicus [TaxId: 10116]}
tvpydmplpggvmprmlitiigtvkpnansitlnfkkgndiafhfnprfnennrrvivcn
tkqdnnwgreerqsafpfesgkpfkiqvlveadhfkvavndvhllqynhrmknlreisql
giigditltsashami

SCOPe Domain Coordinates for d7cxde_:

Click to download the PDB-style file with coordinates for d7cxde_.
(The format of our PDB-style files is described here.)

Timeline for d7cxde_:

  • d7cxde_ is new in SCOPe 2.08-stable