SCOPe 2.04: Domain d1tcoa_: 1tco A:

Lineage for d1tcoa_ (1tco A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56314] (1 PDB entry)

8. Domain d1tcoa_: 1tco A: [42084]
   Other proteins in same PDB: d1tcob_, d1tcoc_
   complexed with ca, fe, fk5, myr, po4, zn

Details for d1tcoa_

PDB Entry: 1tco, 2.5 Å

PDB Description: ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)

PDB Compounds: (A:) serine/threonine phosphatase b2

SCOPe Domain Sequences for d1tcoa_:

Sequence; same for both SEQRES and ATOM records:

>d1tcoa_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Cow (Bos taurus) [TaxId: 9913]}
vpfppshrltakevfdndgkprvdilkahlmkegrleetvalriitegasilrqeknlld
idapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlylwalkily
pktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnqqflcvhg
glspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntvrgcsyfy
sypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyldvynnkaa
vlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnic

Timeline for d1tcoa_:

• d1tcoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1tcoa_ appears in SCOPe 2.03
  
• d1tcoa_ appears in SCOPe 2.05
  
• d1tcoa_ appears in the current release, SCOPe 2.08